Cat: PA1000-920DB

Recombinant Human DR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DR1;Dr1-associated corepressor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q01658

  • Expression Region

    1-176aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMASSSGNDDDLTIPRAAINKMIKETLPNVR VANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGF GSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKAR QQQAELAQQEWLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DR1, or down-regulator of transcription 1, is a protein that plays a crucial role in the regulation of gene expression and transcriptional processes. Its primary function involves the interaction with various transcription factors and RNA polymerase, which can influence the transcriptional activity of specific genes. Research on DR1 has gained significance due to its potential implications in various biological processes, including cell differentiation, proliferation, and response to environmental stimuli. Dysregulation of DR1 expression has been linked to several diseases, including cancer and other disorders related to cellular signaling and growth. Furthermore, understanding the structural and functional properties of DR1 can provide insights into its mechanism of action and its role in cellular pathways. Consequently, the development of recombinant DR1 protein is critical for studying its biological functions in vitro and in vivo, enabling researchers to dissect the complex regulatory networks involving this protein. Investigating DR1 through recombinant techniques can lead to novel therapeutic approaches and the potential identification of drug targets, making it a vital focus in molecular biology and biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US