Analytical Data
-
Gene name
APX2
- Application
-
Alternative Names
APX2；SS622；L-ascorbate peroxidase 2. cytosolic
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q1PER6
-
Expression Region
4-250aa
-
AA Sequence
KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK
-
Molecular Weight
31.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APX2 (Ascorbate Peroxidase 2) is a crucial enzyme involved in the detoxification of hydrogen peroxide in plants, playing a significant role in their response to oxidative stress. This enzyme is part of the ascorbate-glutathione cycle, which is essential for maintaining cellular redox balance and protecting against oxidative damage. Research on APX2 has gained prominence due to its implications in enhancing plant stress tolerance, improving crop yield, and understanding plant resilience mechanisms under adverse environmental conditions. With increasing concerns about climate change and its impact on agriculture, APX2 is of particular interest for genetic engineering and crop improvement strategies. The study of APX2 recombinant proteins has facilitated a deeper understanding of its structure-function relationships, catalytic mechanisms, and interaction with other protective pathways in plants. Additionally, the expression of APX2 in model organisms has provided valuable insights into its physiological roles and potential applications in biotechnological advancements aimed at developing stress-resistant crops. Overall, the investigation of APX2 recombinant proteins not only contributes to fundamental plant biology but also holds potential for practical applications in sustainable agriculture.
