Analytical Data
-
Gene name
DPPA5
- Application
-
Alternative Names
DPPA5；ESG1;Developmental pluripotency-associated 5 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NC42
-
Expression Region
1-116aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGS MGTLPARRHIPPWVKVPEDLKDPEV FQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVVYGSYL YKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DPPA5, or Developmental Pluripotency-Associated 5, is a key regulator in the context of pluripotency and stem cell biology. Originally identified as a gene expressed in embryonic stem cells, DPPA5 plays a crucial role in maintaining the undifferentiated state of these cells and promoting their self-renewal capabilities. Its expression is tightly controlled during early embryonic development, suggesting that it may also have important implications in processes such as cellular reprogramming and differentiation. Research has shown that DPPA5 interacts with various transcription factors and signaling pathways, contributing to the epigenetic landscape that defines pluripotent cells. Furthermore, the study of DPPA5 has garnered interest in the context of regenerative medicine, as understanding its functions and mechanisms could enhance strategies for generating pluripotent stem cells from somatic cells. By creating recombinant DPPA5 proteins for in vitro studies, researchers aim to dissect its molecular interactions and functional roles further, which could lead to innovative therapeutic approaches in treating diseases associated with stem cell dysfunction. As DPPA5 continues to be explored, it remains a valuable candidate for advancing our understanding of stem cell biology and improving stem cell-based therapies.
