Analytical Data
-
Gene name
IgG3
- Application
-
Alternative Names
IgG3；Immunoglobulin heavy constant gamma 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01860
-
Expression Region
1-446aa
-
AA Sequence
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA
-
Molecular Weight
49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Immunoglobulin G3 (IgG3) is one of the four subclasses of IgG antibodies, known for its potent ability to activate complement pathways and mediate immune responses. Its distinct structural features, characterized by a longer hinge region and greater flexibility, allow IgG3 to effectively bind to antigens and enhance opsonization and phagocytosis by immune cells. Research on recombinant IgG3 proteins has gained momentum due to their potential applications in therapeutics and diagnostics. For instance, recombinant IgG3 antibodies are being explored for their efficacy in targeting various diseases, including cancers and autoimmune disorders, by harnessing their superior binding capabilities. Moreover, advancements in genetic engineering techniques have enabled the production of IgG3 antibodies with optimized properties, such as enhanced stability, modified affinities, and tailored effector functions. This aligns with the growing interest in monoclonal antibody therapies, which leverage the unique attributes of different IgG subclasses to improve treatment outcomes. Furthermore, understanding the immunogenicity and pharmacokinetics of recombinant IgG3 can provide valuable insights into its application in clinical settings. Overall, the study of recombinant IgG3 proteins is poised to contribute significantly to the development of innovative immunotherapies and diagnostic tools, highlighting the need for ongoing research in this promising area.
