Analytical Data
-
Gene name
rpsO
- Application
-
Alternative Names
rpsO；secC；Small ribosomal subunit Protein uS15
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0ADZ4
-
Expression Region
2-89aa
-
AA Sequence
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
-
Molecular Weight
14.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
rpsO is a crucial protein that encodes the ribosomal protein S15, which is a component of the 30S ribosomal subunit in prokaryotes. This protein plays a significant role in the assembly and function of the ribosome, directly impacting protein synthesis. Given its essential role in translation, rpsO is of great interest not only in understanding fundamental biological processes but also in the context of antibiotic development. Many antibiotics target bacterial ribosomes, inhibiting protein synthesis, which presents rpsO as a potential target for therapeutic interventions. Additionally, mutations or variations in the rpsO gene can lead to antibiotic resistance, making it vital to study the structure, function, and expression of rpsO in various bacterial strains. Research into recombinant rpsO proteins allows for detailed characterization of its properties and interactions, providing insights into ribosomal function and the mechanisms of resistance. This knowledge can inform the design of new antibiotics or strategies to mitigate resistance, making rpsO research a critical area in molecular biology and infectious disease management.
