Cat: PA1000-871DB

Recombinant Human DHH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DHH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DHH;Desert hedgehog Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43323

  • Expression Region

    23-198aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMIIGPGRGPVGRRRYARKQLVPLLYKQ FVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADR LMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRAL DITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAG G

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DHH (Desert Hedgehog) is a member of the Hedgehog signaling pathway, which plays a crucial role in embryonic development, cell differentiation, and tissue patterning. Its involvement in various biological processes has garnered significant interest in the scientific community, particularly regarding its implications in developmental disorders and cancer. Researchers have focused on the study of DHH recombinant proteins to investigate the intricate mechanisms of Hedgehog signaling and its functional roles in various cellular contexts. By using recombinant technology, scientists can produce DHH in a controlled environment, allowing for detailed analyses of its structure, function, and interaction with signaling receptors. Furthermore, understanding how DHH operates at the molecular level can lead to insights into therapeutic strategies for diseases associated with its dysregulation. The production and characterization of DHH recombinant proteins serve as a valuable tool for dissecting the pathways influenced by Hedgehog proteins, ultimately contributing to advancements in regenerative medicine and cancer treatment. This research holds promise for uncovering novel interventions that target DHH's role in pathologies, potentially leading to more effective treatments and better patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US