Analytical Data
-
Gene name
IgA2
- Application
-
Alternative Names
IgA2；Immunoglobulin A1 protease autotransporter
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DOX2
-
Expression Region
1-455aa
-
AA Sequence
EVQLVETGGGLIQPGGSLRLSCAASGFTVSNHSMSWVRQAPGKALEWVSAIYRGGTTYYADSVKGRFTISRDDSRNTVYLQMNSLRAEDTAVYYCARDLAAARLFGKGTTVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNSSQDVTVPCRVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVEGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTYAVTSILRVAAEDWKKGETFSCMVGHEALPLAFTQKTIDRLAGKPTHINVSVVMAEADGTCY
-
Molecular Weight
48.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Immunoglobulin A (IgA) is one of the most abundant antibodies in mucosal areas, playing a critical role in the immune response by protecting mucosal surfaces from pathogens. IgA exists in two subclasses: IgA1 and IgA2, with IgA2 being particularly prevalent in mucosal tissues. Research on recombinant IgA2 proteins has gained traction due to their potential therapeutic applications, including their role in vaccine development and as a treatment for various mucosal diseases. Unlike IgA1, which is sensitive to cleavage by certain bacterial enzymes, IgA2 is more resistant, making it a favorable candidate for use in hostile environments such as the gastrointestinal tract. Moreover, the ability to produce recombinant IgA2 allows for the exploration of its unique properties and functions, offering insights into mucosal immunity and enabling the design of novel immunotherapeutics. Advances in recombinant DNA technology have facilitated the production of IgA2 in various expression systems, enhancing our understanding of its structure-function relationship. Furthermore, studies have shown that IgA2 engages with a diverse array of pathogens, highlighting its versatility and importance in the adaptive immune response. The ongoing research into IgA2 recombinant proteins not only augments our foundational knowledge of mucosal immunity but also paves the way for innovative approaches to prevent and treat infectious and inflammatory diseases.
