Analytical Data
-
Gene name
rpsF
- Application
-
Alternative Names
rpsF;spoIIAC;RNA polymerase sigma-F factor
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02358
-
Expression Region
1-131aa
-
AA Sequence
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on the recombined protein RpsF, a ribosomal protein component of the small subunit of prokaryotic ribosomes, has gained significant attention due to its crucial role in protein synthesis and overall cellular function. RpsF, often referred to as S6, is essential for the assembly and stability of the ribosomal small subunit and has been implicated in the regulation of translation fidelity and initiation. Studies indicate that mutations or deficiencies in RpsF can lead to various growth defects and may contribute to antibiotic resistance mechanisms in bacteria. Furthermore, understanding the structure and function of RpsF can provide insights into the evolutionary adaptations of prokaryotic organisms and offer potential targets for novel antimicrobial therapies. Recent advancements in recombinant DNA technology have facilitated the production of RpsF in heterologous systems, allowing researchers to conduct in-depth biochemical and biophysical analyses. This work aims to elucidate the protein's interactions within the ribosomal complex and its functional implications in ribosome biogenesis. The ongoing exploration of RpsF not only enhances our understanding of fundamental biological processes but also holds promise for innovative approaches in combating antibiotic-resistant bacterial strains.











