Analytical Data
-
Gene name
dgcQ
- Application
-
Alternative Names
dgcQ;yedQ;Probable diguanylate cyclase DgcQ
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P76330
-
Expression Region
381-564aa
-
AA Sequence
RRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDNA
-
Molecular Weight
47.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on dgcQ recombinant protein is rooted in the exploration of bacterial signaling pathways, particularly those involving cyclic di-GMP (c-di-GMP), a crucial second messenger that regulates biofilm formation, motility, and virulence in various bacteria. dgcQ encodes a diguanylate cyclase that synthesizes c-di-GMP, modulating bacterial behavior in response to environmental stimuli. Understanding dgcQ’s function and its role in biofilm development is vital for developing strategies to control bacterial infections, especially those associated with chronic diseases and medical devices. In pathogens like Pseudomonas aeruginosa, high levels of c-di-GMP are linked to robust biofilm formation, making dgcQ a potential target for therapeutic intervention. Researchers have been focusing on the heterologous expression and purification of the dgcQ protein to elucidate its enzymatic mechanisms and regulatory pathways, aiming to provide insights into its structure-function relationship. Furthermore, studying dgcQ could pave the way for novel antimicrobial strategies by disrupting its activity to modulate bacterial lifestyles. This research is particularly significant in the context of rising antibiotic resistance, as novel approaches to manage bacterial infections are urgently needed. In summary, research on dgcQ recombinant protein is at the intersection of microbiology and therapeutic development, promising to unlock new avenues for controlling bacterial behavior and addressing public health challenges.











