Cat: PA2000-3620

Recombinant Human dgcQ Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    dgcQ

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    dgcQ;yedQ;Probable diguanylate cyclase DgcQ

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P76330

  • Expression Region

    381-564aa

  • AA Sequence

    RRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDNA

  • Molecular Weight

    47.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on dgcQ recombinant protein is rooted in the exploration of bacterial signaling pathways, particularly those involving cyclic di-GMP (c-di-GMP), a crucial second messenger that regulates biofilm formation, motility, and virulence in various bacteria. dgcQ encodes a diguanylate cyclase that synthesizes c-di-GMP, modulating bacterial behavior in response to environmental stimuli. Understanding dgcQ’s function and its role in biofilm development is vital for developing strategies to control bacterial infections, especially those associated with chronic diseases and medical devices. In pathogens like Pseudomonas aeruginosa, high levels of c-di-GMP are linked to robust biofilm formation, making dgcQ a potential target for therapeutic intervention. Researchers have been focusing on the heterologous expression and purification of the dgcQ protein to elucidate its enzymatic mechanisms and regulatory pathways, aiming to provide insights into its structure-function relationship. Furthermore, studying dgcQ could pave the way for novel antimicrobial strategies by disrupting its activity to modulate bacterial lifestyles. This research is particularly significant in the context of rising antibiotic resistance, as novel approaches to manage bacterial infections are urgently needed. In summary, research on dgcQ recombinant protein is at the intersection of microbiology and therapeutic development, promising to unlock new avenues for controlling bacterial behavior and addressing public health challenges.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US