Cat: PA1000-9498

Recombinant Human OBP2A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OBP2A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OBP2A;Odorant-binding Protein 2a

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NY56

  • Expression Region

    16-170aa

  • AA Sequence

    LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYSKDQRRGGLRYMGNLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH

  • Molecular Weight

    30.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OBP2A (Olfactory Binding Protein 2A) is a member of the odorant-binding protein family that plays a crucial role in the olfactory system by binding and transporting odorant molecules. Its expression is predominantly observed in non-sensory tissues, including various organs, which has led researchers to investigate its potential roles beyond olfaction, such as in cellular signaling, immune response, and tissue development. The study of OBP2A recombinant protein is particularly significant for several reasons: it enables a deeper understanding of olfactory mechanisms and provides insights into the molecular interactions involved in odor detection. Furthermore, the ability to produce OBP2A in recombinant form facilitates the exploration of its structure-function relationships, enabling researchers to identify key residues critical for its binding activity and potential therapeutic applications. As OBP2A may also interact with environmental toxins or pheromones, studying its properties could yield valuable information regarding its function in various ecological contexts. Overall, the research on OBP2A recombinant protein holds promise for advancing our comprehension of sensory biology, as well as its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US