Cat: PA1000-856DB

Recombinant Human DECR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DECR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DECR1;DECR;SDR18C1;2.4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16698

  • Expression Region

    35-335aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHM NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGA QCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKV AGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLI KAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMR FNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFL CSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKG S

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DECR1, or Decorin-Related Protein 1, is a member of the short-chain dehydrogenase/reductase (SDR) family, playing a crucial role in various biological processes, including lipid metabolism and oxidative stress responses. Its involvement in metabolic regulation has attracted attention in recent years, particularly in the context of metabolic disorders such as obesity, diabetes, and cardiovascular diseases. DECR1 functions as a key enzyme in the peroxisomal β-oxidation of fatty acids, contributing to the maintenance of cellular homeostasis and energy balance. Emerging studies suggest that DECR1 may affect mitochondrial function and reactive oxygen species (ROS) production, linking it to inflammation and cellular aging. Given these critical roles, researchers are increasingly focused on the molecular mechanisms underlying DECR1's biological functions, aiming to explore its potential as a therapeutic target for metabolic diseases. Understanding DECR1's structure, enzymatic activity, and regulatory pathways could provide deeper insights into metabolic health and disease mechanisms, making it a significant protein in both basic and applied biomedical research. The characterization of DECR1 recombinant proteins allows for the exploration of its enzymatic properties and interactions with other cellular components, paving the way for potential interventions in metabolic dysfunction and related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US