Analytical Data
-
Gene name
RELT
- Application
-
Alternative Names
RELT；RELT-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969Z4
-
Expression Region
26-153aa
-
AA Sequence
STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA
-
Molecular Weight
17.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RELT (receptor expressed in lymphoid tissues) is a recently discovered member of the tumor necrosis factor (TNF) receptor superfamily, which plays a pivotal role in immune regulation and cell signaling. Initial studies have identified RELT as a key player in mediating anti-tumor responses and influencing lymphocyte activation. Research has indicated that RELT is involved in various physiological processes, including immune cell differentiation and survival, thereby making it a potential therapeutic target for immune-related disorders and malignancies. The protein's unique structural features and its expression profile in different tissues highlight its importance in both innate and adaptive immunity. Investigating RELT as a recombinant protein offers valuable insights into its functional mechanisms and interaction with various signaling pathways, paving the way for potential applications in vaccine development and immunotherapy. Moreover, understanding the precise role of RELT can enhance our comprehension of complex immune responses and facilitate the design of more effective treatments for diseases characterized by immune dysregulation, such as cancer and autoimmune disorders. As research progresses, the characterization of RELT and its signaling pathways could lead to innovative strategies for manipulating immune responses, ultimately benefiting therapeutic interventions.
