Cat: PA1000-9496

Recombinant Human GLUT3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GLUT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GLUT3;GLUT3;Solute carrier family 2. facilitated glucose transporter member 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11169

  • Expression Region

    1-496aa

  • AA Sequence

    MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKG NAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLL AVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTAL RGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSA ALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMS QEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAG VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMT VSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPA AMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKV PETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV

  • Molecular Weight

    80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GLUT3 (Glucose Transporter Type 3) is a critical member of the glucose transporter family, primarily responsible for facilitating glucose uptake in neurons and other tissues with high-energy demands. Due to its significant role in maintaining glucose homeostasis and its involvement in various neurological functions, GLUT3 has attracted considerable attention in research, particularly regarding its implications in neurological disorders and metabolic diseases. The understanding of GLUT3's structure, function, and regulatory mechanisms is essential for developing therapeutic strategies targeting metabolic dysregulation in conditions like diabetes, obesity, and neurodegenerative diseases. Recombinant protein studies of GLUT3 provide valuable insights into its kinetic properties, substrate specificity, and interaction with different ligands. By employing techniques such as heterologous expression in yeast or mammalian cells, researchers are able to produce functional GLUT3 for detailed biochemical and pharmacological characterizations. Furthermore, elucidating the structural aspects of GLUT3 using techniques like X-ray crystallography or cryo-electron microscopy could pave the way for the design of novel drugs that specifically modulate GLUT3 activity, potentially offering new avenues for treating diseases linked to glucose metabolism. Understanding GLUT3 not only enhances our grasp of fundamental cellular processes but also shapes our approach to addressing metabolic and neurological disorders prevalent in contemporary society.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US