Analytical Data
-
Gene name
NDM1
- Application
-
Alternative Names
NDM1;
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A6C0L5R1
-
Expression Region
1-85aa
-
AA Sequence
MTLTNILVNAGVKVRLTDAYKIHHDKVIIIDRSTVETGSFNFTKAAEYSNSENALVLNDMPQVASVYLEHWQSRWETGRDWKSTY
-
Molecular Weight
9.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDM-1 (New Delhi Metallo-β-lactamase-1) is an enzyme that confers resistance to a broad range of β-lactam antibiotics, including penicillins and cephalosporins, rendering many standard treatments ineffective. First identified in New Delhi, India, this plasmid-encoded enzyme has become a significant public health threat due to its ability to spread among various bacterial pathogens, particularly Enterobacteriaceae. The emergence of NDM-1 has raised serious concerns regarding antibiotic-resistant infections, leading researchers to investigate its structure and function. Recombinant NDM-1 proteins are essential for understanding the enzyme's mechanism of action, interactions with different antibiotics, and the molecular basis of its resistance. By producing NDM-1 in vitro using recombinant DNA technology, scientists can study its biochemical properties, such as enzymatic activity and catalytic efficiency, and evaluate potential inhibitors that could restore antibiotic efficacy. Moreover, insights gained from studying NDM-1 can inform strategies for combating multi-drug-resistant infections, emphasizing the importance of developing novel therapeutic approaches and diagnostics in the fight against antibiotic resistance. Overall, the exploration of NDM-1 and its recombinant proteins is crucial for addressing an escalating global health crisis posed by antibiotic-resistant bacteria.











