Cat: PA2000-3617

Recombinant E.coli NDM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NDM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NDM1;

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0A6C0L5R1

  • Expression Region

    1-85aa

  • AA Sequence

    MTLTNILVNAGVKVRLTDAYKIHHDKVIIIDRSTVETGSFNFTKAAEYSNSENALVLNDMPQVASVYLEHWQSRWETGRDWKSTY

  • Molecular Weight

    9.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NDM-1 (New Delhi Metallo-β-lactamase-1) is an enzyme that confers resistance to a broad range of β-lactam antibiotics, including penicillins and cephalosporins, rendering many standard treatments ineffective. First identified in New Delhi, India, this plasmid-encoded enzyme has become a significant public health threat due to its ability to spread among various bacterial pathogens, particularly Enterobacteriaceae. The emergence of NDM-1 has raised serious concerns regarding antibiotic-resistant infections, leading researchers to investigate its structure and function. Recombinant NDM-1 proteins are essential for understanding the enzyme's mechanism of action, interactions with different antibiotics, and the molecular basis of its resistance. By producing NDM-1 in vitro using recombinant DNA technology, scientists can study its biochemical properties, such as enzymatic activity and catalytic efficiency, and evaluate potential inhibitors that could restore antibiotic efficacy. Moreover, insights gained from studying NDM-1 can inform strategies for combating multi-drug-resistant infections, emphasizing the importance of developing novel therapeutic approaches and diagnostics in the fight against antibiotic resistance. Overall, the exploration of NDM-1 and its recombinant proteins is crucial for addressing an escalating global health crisis posed by antibiotic-resistant bacteria.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US