Analytical Data
-
Gene name
MRPL9
- Application
-
Alternative Names
MRPL9；Large ribosomal subunit Protein bL9m
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYD2
-
Expression Region
60-267aa
-
AA Sequence
WKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPEEPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAMAPTSPQI
-
Molecular Weight
50.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRPL9, or Mitochondrial Ribosomal Protein L9, is a crucial component of the mitochondrial ribosome, playing a significant role in mitochondrial protein synthesis. Mitochondria, often referred to as the powerhouses of the cell, are essential for energy production and have their own distinct genetic material, which necessitates their specialized ribosomal machinery. The study of MRPL9 and its function is particularly important in the context of mitochondrial diseases and disorders, which can arise from mutations in mitochondrial genes or disruptions in mitochondrial protein synthesis. Understanding the structure and function of MRPL9 can provide insights into the mechanisms underlying these diseases, as well as potential therapeutic targets. Recent advancements in recombinant protein technology have enabled researchers to produce MRPL9 in vitro, allowing for detailed biochemical and structural studies. These studies aim to elucidate the role of MRPL9 in ribosomal assembly and its interactions with other mitochondrial components. Additionally, investigating the post-translational modifications of MRPL9 can shed light on its regulatory mechanisms in mitochondrial translation. As research progresses, the characterization of MRPL9 and its implications in mitochondrial biology may contribute to the development of novel strategies for diagnosing and treating metabolic disorders associated with mitochondrial dysfunction.
