Cat: PA2000-3602

Recombinant Human MRPL9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MRPL9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MRPL9;Large ribosomal subunit Protein bL9m

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BYD2

  • Expression Region

    60-267aa

  • AA Sequence

    WKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPEEPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAMAPTSPQI

  • Molecular Weight

    50.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MRPL9, or Mitochondrial Ribosomal Protein L9, is a crucial component of the mitochondrial ribosome, playing a significant role in mitochondrial protein synthesis. Mitochondria, often referred to as the powerhouses of the cell, are essential for energy production and have their own distinct genetic material, which necessitates their specialized ribosomal machinery. The study of MRPL9 and its function is particularly important in the context of mitochondrial diseases and disorders, which can arise from mutations in mitochondrial genes or disruptions in mitochondrial protein synthesis. Understanding the structure and function of MRPL9 can provide insights into the mechanisms underlying these diseases, as well as potential therapeutic targets. Recent advancements in recombinant protein technology have enabled researchers to produce MRPL9 in vitro, allowing for detailed biochemical and structural studies. These studies aim to elucidate the role of MRPL9 in ribosomal assembly and its interactions with other mitochondrial components. Additionally, investigating the post-translational modifications of MRPL9 can shed light on its regulatory mechanisms in mitochondrial translation. As research progresses, the characterization of MRPL9 and its implications in mitochondrial biology may contribute to the development of novel strategies for diagnosing and treating metabolic disorders associated with mitochondrial dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US