Analytical Data
-
Gene name
ZNF91
- Application
-
Alternative Names
ZNF91；Zinc finger Protein 91
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q05481
-
Expression Region
1-208aa
-
AA Sequence
MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQIL
-
Molecular Weight
51.4 KD
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF91, a member of the zinc finger protein family, plays a critical role in gene expression regulation and various cellular processes, including proliferation and differentiation. As a transcription factor, ZNF91 is known for its ability to bind to DNA and modulate the transcription of target genes, thereby influencing critical biological pathways. Recent studies have highlighted ZNF91's involvement in cellular responses to stress and its potential implications in diseases such as cancer and viral infections. Despite its biological significance, the detailed mechanisms of ZNF91 function and regulation remain poorly understood. Additionally, the potential of ZNF91 as a therapeutic target prompts further investigation into its structure and function. Recombinant ZNF91 proteins can facilitate high-throughput screening and structural analysis, allowing researchers to explore its biological activity and interactions with other cellular components. The study of ZNF91 recombinant proteins therefore represents a promising avenue to uncover novel insights into its role in health and disease, paving the way for potential therapeutic applications. Understanding ZNF91's functional dynamics can provide deeper insights into gene regulatory networks and their contributions to cellular homeostasis and pathology.
