Analytical Data
-
Gene name
CXCL9
- Application
-
Alternative Names
CXCL9；CMK；MIG；SCYB9;C-X-C motif chemokine 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07325
-
Expression Region
23-125aa
-
AA Sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQ TCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQK KTT
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCL9, also known as MIG (Monokine Induced by Gamma Interferon), is a chemokine that plays a crucial role in immune responses, particularly in recruiting T cells and natural killer (NK) cells to sites of inflammation and infection. Its primary function is to bind to the CXCR3 receptor, which is upregulated on activated T cells and NK cells, facilitating their migration toward areas of CXCL9 expression. Research has increasingly focused on CXCL9 due to its potential therapeutic applications in various diseases, including cancer, autoimmune disorders, and viral infections. In cancer immunotherapy, CXCL9 is of great interest because it can enhance T cell infiltration into tumors, potentially improving the efficacy of immune checkpoint inhibitors. Additionally, its role in modulating the immune microenvironment makes it a potential target for drug development. Recombinant CXCL9 protein has been investigated for its ability to stimulate immune responses in preclinical and clinical studies. Understanding the mechanisms by which CXCL9 influences immune cell behavior and its interactions with other chemokines and cytokines is essential for developing effective therapies. As such, the production and characterization of recombinant CXCL9 allow researchers to explore its biological functions further and assess its clinical relevance in various therapeutic contexts. Overall, the ongoing research into CXCL9 and its recombinant protein form offers promising insights into the modulation of immune responses and the advancement of targeted therapies in immunology and oncology.
