Cat: PA1000-795DB

Recombinant Human CXCL13 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CXCL13

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CXCL13;BCA1;BLC;SCYB13;C-X-C motif chemokine 13

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q53X90

  • Expression Region

    23-109aa

  • AA Sequence

    VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNK SIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

  • Molecular Weight

    10 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CXCL13, a chemokine belonging to the CXC family, plays a crucial role in B cell development and localization within secondary lymphoid organs. It is primarily produced by follicular dendritic cells and is essential for the formation and maintenance of B cell follicles and germinal centers. Research has indicated that CXCL13 is not only pivotal in normal immune responses but also implicated in various pathological conditions such as autoimmune diseases, lymphomas, and chronic infections. The ability of CXCL13 to attract B cells and its involvement in the formation of ectopic lymphoid structures highlight its potential as a therapeutic target. Recent studies have moved towards the development of recombinant CXCL13 proteins to further explore its functions and mechanisms in both healthy and diseased states. These recombinant proteins can be used in various experimental setups, including in vivo models, to investigate their roles in immune responses, B cell trafficking, and tissue organization. The study of CXCL13 and its recombinant forms may yield insights into targeted therapies for immune-related disorders, making it a significant focus within immunology and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US