Analytical Data
-
Gene name
CXCL13
- Application
-
Alternative Names
CXCL13；BCA1；BLC；SCYB13;C-X-C motif chemokine 13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53X90
-
Expression Region
23-109aa
-
AA Sequence
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNK SIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
-
Molecular Weight
10 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCL13, a chemokine belonging to the CXC family, plays a crucial role in B cell development and localization within secondary lymphoid organs. It is primarily produced by follicular dendritic cells and is essential for the formation and maintenance of B cell follicles and germinal centers. Research has indicated that CXCL13 is not only pivotal in normal immune responses but also implicated in various pathological conditions such as autoimmune diseases, lymphomas, and chronic infections. The ability of CXCL13 to attract B cells and its involvement in the formation of ectopic lymphoid structures highlight its potential as a therapeutic target. Recent studies have moved towards the development of recombinant CXCL13 proteins to further explore its functions and mechanisms in both healthy and diseased states. These recombinant proteins can be used in various experimental setups, including in vivo models, to investigate their roles in immune responses, B cell trafficking, and tissue organization. The study of CXCL13 and its recombinant forms may yield insights into targeted therapies for immune-related disorders, making it a significant focus within immunology and therapeutic development.
