Analytical Data
-
Gene name
GUCA2A
- Application
-
Alternative Names
GUCA2A;GUCA2;Guanylin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02747
-
Expression Region
1-115aa
-
AA Sequence
MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
-
Molecular Weight
12.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GUCA2A, or Guanylate Cyclase Activator 2A, is a key protein involved in the regulation of electrolyte and fluid balance in the retinal pigment epithelium (RPE) and plays a crucial role in phototransduction, the process by which light is converted into electrical signals in the retina. Its dysfunction has been associated with various retinal disorders, making it a significant target for research in ocular diseases. The study of recombinant GUCA2A protein has gained momentum due to its potential therapeutic applications in treating conditions such as retinal degeneration and age-related macular degeneration. Understanding the structure and function of GUCA2A at a molecular level can provide insights into its mechanisms of action and interaction with other cellular components. Additionally, recombinant GUCA2A can be utilized in pharmacological studies, enabling researchers to explore its role in intracellular signaling pathways and its potential as a drug candidate. By elucidating the biological functions and therapeutic implications of GUCA2A, researchers aim to develop innovative strategies for addressing retinal diseases, thereby improving visual health and quality of life for affected individuals. Overall, the investigation of GUCA2A recombinant protein represents a critical intersection of molecular biology, pharmacology, and clinical application in the fight against debilitating visual impairments.











