Cat: PA1000-9449

Recombinant Human GUCA2A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GUCA2A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GUCA2A;GUCA2;Guanylin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q02747

  • Expression Region

    1-115aa

  • AA Sequence

    MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

  • Molecular Weight

    12.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GUCA2A, or Guanylate Cyclase Activator 2A, is a key protein involved in the regulation of electrolyte and fluid balance in the retinal pigment epithelium (RPE) and plays a crucial role in phototransduction, the process by which light is converted into electrical signals in the retina. Its dysfunction has been associated with various retinal disorders, making it a significant target for research in ocular diseases. The study of recombinant GUCA2A protein has gained momentum due to its potential therapeutic applications in treating conditions such as retinal degeneration and age-related macular degeneration. Understanding the structure and function of GUCA2A at a molecular level can provide insights into its mechanisms of action and interaction with other cellular components. Additionally, recombinant GUCA2A can be utilized in pharmacological studies, enabling researchers to explore its role in intracellular signaling pathways and its potential as a drug candidate. By elucidating the biological functions and therapeutic implications of GUCA2A, researchers aim to develop innovative strategies for addressing retinal diseases, thereby improving visual health and quality of life for affected individuals. Overall, the investigation of GUCA2A recombinant protein represents a critical intersection of molecular biology, pharmacology, and clinical application in the fight against debilitating visual impairments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US