Analytical Data
-
Gene name
COLEC11
- Application
-
Alternative Names
COLEC11；Collectin-11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BWP8
-
Expression Region
26-271aa
-
AA Sequence
QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQ KGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEM DNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGG TLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTF NKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COLEC11, also known as Collectin 11, is a member of the collectin family of proteins, which play a pivotal role in the innate immune response by recognizing and binding to various pathogens. Research into COLEC11 has gained momentum due to its unique structural characteristics and functional implications in immune regulation. Unlike other collectins, COLEC11 is predominantly expressed in the human respiratory tract and has been associated with the recognition of a diverse range of microorganisms, including bacteria and fungi. Studies have indicated that COLEC11 can enhance opsonization and phagocytosis, suggesting its potential as a key player in host defense mechanisms. Additionally, there is growing interest in understanding COLEC11’s role in autoimmune diseases and inflammatory responses, given its capacity to modulate immune functions. Exploring the recombinant expression of COLEC11 can facilitate the development of diagnostic tools and therapeutic strategies targeting infections and immune disorders. Through structural elucidation and functional assays, research on COLEC11 not only enhances our understanding of innate immunity but also paves the way for novel interventions in managing infectious diseases and autoimmune conditions. As such, COLEC11 represents a promising target for further investigation in immunological research and clinical applications.
