Analytical Data
-
Gene name
PAM16
- Application
-
Alternative Names
PAM16；MAGMAS；TIM16；TIMM16；Mitochondrial import inner membrane translocase subunit TIM16
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3D7
-
Expression Region
1-125aa
-
AA Sequence
MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
-
Molecular Weight
40.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PAM16, a mitochondrial protein, is part of the PAM complex involved in protein translocation across the inner mitochondrial membrane. Its role in facilitating the import of precursor proteins into the mitochondria is crucial for maintaining mitochondrial function and energy production. Dysfunction of PAM16 has been associated with various mitochondrial diseases, underscoring the importance of this protein in cellular metabolism and health. Recent studies have shown that PAM16 interacts with other components of the translocase of the inner mitochondrial membrane (TIM) complex, critical for understanding how proteins are folded and processed within mitochondria. Investigating PAM16 and its interactions may reveal insights into mitochondrial biogenesis, proper organelle functioning, and the molecular mechanisms underlying mitochondrial disorders. As research progresses, elucidating the precise mechanisms by which PAM16 operates could lead to potential therapeutic strategies aimed at treating diseases linked to mitochondrial dysfunction, thus emphasizing its significance in both basic research and clinical applications.
