Analytical Data
-
Gene name
CRIP1
- Application
-
Alternative Names
CRIP1；CRIP；CRP1;Cysteine-rich Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50238
-
Expression Region
2-77aa
-
AA Sequence
PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
-
Molecular Weight
40.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRIP1, or cysteine-rich protein 1, is a member of the CRIP family, characterized by its unique zinc-finger motifs and its involvement in various cellular processes. Initially identified in the context of developmental biology, CRIP1 plays a critical role in cell growth, differentiation, and apoptosis. Its expression is often regulated during key developmental stages, suggesting a significant function in tissue development and maintenance. Recent studies indicate that CRIP1 is implicated in several pathological conditions, including cancer, where its expression levels may correlate with tumor progression and metastasis. The research surrounding CRIP1 recombinant proteins has gained momentum, as scientists aim to elucidate its precise biological functions and molecular mechanisms. By producing CRIP1 in recombinant systems, researchers can perform structural and functional analyses, investigate its interactions with other biomolecules, and explore its potential as a therapeutic target. Furthermore, the generation of CRIP1 recombinant proteins allows for the development of assays and models to study its role in disease processes, advancing both fundamental biology and potential clinical applications. Thus, CRIP1 stands at the intersection of developmental biology and medical research, making it a focal point for investigations into its diverse biological roles and therapeutic implications.
