Cat: PA1000-709DB

Recombinant Human CRHBP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRHBP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRHBP;CRFBP;Corticotropin-releasing factor-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P24387

  • Expression Region

    25-322aa

  • AA Sequence

    YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTA DRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFP SSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTI KTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGH VNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMK VGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGLVD HHHHHH

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRHBP (Corticotropin-Releasing Hormone Binding Protein) is essential in the regulation of the hypothalamic-pituitary-adrenal (HPA) axis and plays a significant role in the stress response. As a high-affinity binding protein for corticotropin-releasing hormone (CRH), CRHBP modulates the availability of CRH, thereby influencing the secretion of adrenocorticotropic hormone (ACTH) and cortisol. Dysregulation of this pathway has been implicated in various psychological disorders, including depression, anxiety, and post-traumatic stress disorder (PTSD). Consequently, understanding CRHBP's structure and function is crucial for developing therapeutic strategies targeting stress-related conditions. Recent advancements in recombinant protein technology have enabled the production of CRHBP in vitro, providing a valuable tool for studying its characteristics and interactions. These studies focus on the protein's affinity, structure-activity relationships, and its role in binding to CRH. Additionally, investigations into CRHBP's potential as a biomarker for stress-related disorders and as a therapeutic target have gained momentum. Overall, research on recombinant CRHBP promises to enrich our understanding of the neuroendocrine mechanisms underlying stress responses and offers new avenues for intervention in mental health disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US