Analytical Data
-
Gene name
CPSF4
- Application
-
Alternative Names
CPSF4；CPSF30；NAR；NEB1;Cleavage and polyadenylation specificity factor subunit 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95639
-
Expression Region
1-244aa
-
AA Sequence
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
-
Molecular Weight
54.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CPSF4, or Cleavage and Polyadenylation Specificity Factor 4, is an essential protein involved in the critical process of mRNA maturation, particularly in the cleavage and polyadenylation of pre-mRNA. This protein is part of the larger CPSF complex, which recognizes the polyadenylation signal in mRNA precursors and facilitates the cleavage and subsequent addition of a poly(A) tail. Research on CPSF4 has gained prominence due to its pivotal role in gene expression regulation, with implications in various biological processes, including cell proliferation, differentiation, and response to stress. Dysregulation of CPSF4 has been linked to several diseases, including cancer, making it a potential target for therapeutic interventions. Given its importance, studies have focused on the structural characterization of CPSF4, its interaction with other proteins in the polyadenylation machinery, and the regulatory mechanisms that control its activity. Understanding the function and regulation of CPSF4 not only contributes to the fundamental knowledge of mRNA processing but also opens avenues for the development of novel strategies to combat diseases associated with its malfunction. As such, the recombinant production of CPSF4 has become a vital step in dissecting its biological functions and interactions in the cellular context, offering insights into its potential as a biomarker or therapeutic target in various pathological conditions.
