Cat: PA1000-699DB

Recombinant Human CPPED1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CPPED1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CPPED1;CSTP1;Serine/threonine-Protein phosphatase CPPED1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BRF8

  • Expression Region

    1-314aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSAAEAGGVFHRARGRTLAAFPAEKES EWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQAVQAINK LNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIPLVLVSGN HDIGNTPTAETVEEFCRTWGDDYFSFWVGGVLFLVLNSQFYENPSKCPSL KQAQDQWLDEQLSIARQRHCQHAIVFQHIPLFLESIDEDDDYYFNLSKST RKKLADKFIHAGVKVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHG LRVVVVTAEKIVHRYYSLDELSEKGIEDDLMDLIKKK

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CPPED1 (C-terminal PDZ-binding protein 1) is a relatively newly discovered protein that plays a crucial role in various cellular processes, including cell adhesion, migration, and signaling pathways. Characterized by its PDZ-binding motif, CPPED1 interacts with a variety of proteins, thus influencing cellular functions and the organization of cell signaling complexes. Research indicates that CPPED1 is implicated in the regulation of cellular responses to external stimuli, making it a significant player in developmental biology and disease processes. Studies have shown that alterations in CPPED1 expression or function may contribute to various pathological conditions, including cancer progression and metastasis. As such, recombinant CPPED1 protein has emerged as a valuable tool for researchers aiming to elucidate its biological functions and therapeutic potential. The generation of this recombinant protein allows for detailed biochemical assays and cellular experiments, helping to uncover the underlying mechanisms of CPPED1 in cellular interactions and signaling. Moreover, understanding the role of CPPED1 in disease states could pave the way for novel therapeutic strategies, highlighting the importance of continued research in this arena.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US