Analytical Data
-
Gene name
CXCR4
- Application
-
Alternative Names
CXCR4；C-X-C chemokine receptor type 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61073
-
Expression Region
1-46aa
-
AA Sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCR4, a chemokine receptor, plays a crucial role in various physiological and pathological processes, including hematopoiesis, immune response, and cancer metastasis. The receptor is primarily known for its involvement in the migration of immune cells, particularly T cells and stem cells, to sites of infection or inflammation. Its interaction with the ligand CXCL12 (also known as SDF-1) is vital for these processes. Research has shown that CXCR4 is overexpressed in several types of cancers, contributing to tumor progression, metastasis, and resistance to therapy. Given its significant role in these critical biological functions, CXCR4 has emerged as an attractive therapeutic target. The development of CXCR4 recombinant proteins is essential for understanding its structure-function relationships, molecular mechanisms of action, and interactions with ligands and drugs. These recombinant proteins pave the way for the exploration of CXCR4's role in disease and the development of novel therapeutic strategies, including CXCR4 antagonists that could inhibit cancer metastasis and improve therapeutic outcomes in patients. Additionally, the study of CXCR4 recombinant proteins can enhance our understanding of other conditions, such as HIV infection, where CXCR4 acts as a co-receptor, thereby facilitating the search for new antiviral therapies. Overall, the research surrounding CXCR4 recombinant proteins stands at the intersection of immunology, oncology, and pharmacology, aiming to unlock new insights into therapy and enhance clinical applications.
