Analytical Data
-
Gene name
CPA4
- Application
-
Alternative Names
CPA4;CYP2A3;Cytochrome P450 2A6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UI42
-
Expression Region
114-421aa
-
AA Sequence
SSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNLY
-
Molecular Weight
41.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CPA4 (Cancer Pathway-Associated 4) is a novel protein that has garnered significant attention in cancer research due to its potential role in tumorigenesis and progression. As an important component of cellular signaling pathways, CPA4 is implicated in various biological processes, including cell proliferation, apoptosis, and metastasis. Research into CPA4 has revealed its overexpression in multiple cancer types, suggesting that it may serve as a biomarker for tumor diagnosis and prognosis. The protein's involvement in the regulation of key oncogenic pathways highlights its potential as a therapeutic target. Moreover, studies have shown that manipulating CPA4 levels can influence cancer cell behavior, making it an attractive candidate for drug development. The increasing focus on personalized medicine also drives the necessity to understand CPA4's functional mechanisms, as it may contribute to the resistance observed in some cancer therapies. Consequently, elucidating the structure and function of CPA4 could pave the way for innovative treatment strategies, ultimately enhancing patient outcomes in cancer therapy.











