Cat: PA1000-9379

Recombinant Human CX3CR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CX3CR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CX3CR1;CMKBRL1;GPR13;CX3C chemokine receptor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49238

  • Expression Region

    1-355aa

  • AA Sequence

    MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNL LVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNA MCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTIS LGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGF LLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVM IFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGD ALLLL

  • Molecular Weight

    65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CX3CR1 is a G protein-coupled receptor that plays a crucial role in immune responses and is involved in the migration of immune cells to sites of inflammation. Its ligand, fractalkine (CX3CL1), exists in both a membrane-bound form and a soluble form, facilitating cell-cell communication during immune activation. Research on CX3CR1 has gained significance due to its implications in various diseases, including cardiovascular diseases, neurodegenerative disorders, and cancer. Understanding the structure and function of CX3CR1 is vital for developing therapeutic strategies targeting immune cell trafficking. Recombinant CX3CR1 protein studies enable scientists to investigate its signaling pathways and interactions with ligands in a controlled environment, shedding light on its role in shaping immune responses. Furthermore, research into CX3CR1's expression patterns and functional variants can reveal its involvement in disease susceptibility, offering potential biomarkers for early detection or treatment response monitoring. Overall, CX3CR1 represents a promising target for innovative therapeutic interventions in immune-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US