Analytical Data
-
Gene name
COPS6
- Application
-
Alternative Names
COPS6；CSN6；HVIP;COP9 signalosome complex subunit 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L5N1
-
Expression Region
1-327aa
-
AA Sequence
MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILN ISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIII DKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPL FLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGV DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV PFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCN TMNQFVNKFNVLYDRQGIGRRMRGLFF
-
Molecular Weight
63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COPS6, also known as COP9 signalosome subunit 6, is a crucial component of the COP9 signalosome (CSN), a multi-protein complex involved in various cellular processes, including protein degradation, signal transduction, and cell cycle regulation. The CSN plays an essential role in the modulation of the ubiquitin-proteasome system, which is vital for maintaining protein homeostasis and cellular function. The dysregulation of COPS6 and the CSN has been linked to several diseases, including cancer, where it can affect tumorigenesis and cellular proliferation. Recent studies have aimed to elucidate the structural and functional characteristics of COPS6 to better understand its role within the CSN and its wider implications in cellular signaling pathways. Moreover, research has focused on the potential of COPS6 as a therapeutic target, as its modulation could offer novel approaches for cancer treatment and other diseases characterized by protein degradation impairments. As a result, the investigation of COPS6 and its associated pathways represents a significant area of interest within the fields of molecular biology and therapeutic development. Understanding the mechanisms governing COPS6 function could provide new insights into cell regulation and open avenues for innovative therapeutic strategies.
