Cat: PA1000-684DB

Recombinant Human COMT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COMT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COMT;Catechol O-methyltransferase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P21964

  • Expression Region

    27-271aa

  • AA Sequence

    RHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVL EAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRM ARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQL KKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGA PDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

  • Molecular Weight

    53 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Catechol-O-methyltransferase (COMT) is an important enzyme involved in the metabolism of catecholamines, including dopamine, epinephrine, and norepinephrine, which play critical roles in the central nervous system and various physiological processes. COMT catalyzes the methylation of catechol compounds, thereby regulating their levels and activity within the brain and other tissues. Dysregulation of COMT activity has been implicated in several neuropsychiatric disorders, including schizophrenia, bipolar disorder, and attention deficit hyperactivity disorder (ADHD), making it a focal point for therapeutic research. The study of recombinant COMT protein is crucial for understanding its structure-function relationships, enzymatic mechanisms, and interactions with other proteins and ligands. By producing and purifying recombinant COMT, researchers can conduct detailed biochemical assays and structural analyses, which are essential for identifying potential inhibitors or activators of the enzyme. Furthermore, studying COMT variants, particularly the Val158Met polymorphism, is significant for exploring genetic influences on enzyme activity and individual susceptibility to mental health disorders. Overall, research on recombinant COMT protein enhances our understanding of its biological role and therapeutic potential, paving the way for innovative strategies in the treatment of COMT-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US