Analytical Data
-
Gene name
COMT
- Application
-
Alternative Names
COMT;Catechol O-methyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21964
-
Expression Region
27-271aa
-
AA Sequence
RHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVL EAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRM ARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQL KKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGA PDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
-
Molecular Weight
53 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Catechol-O-methyltransferase (COMT) is an important enzyme involved in the metabolism of catecholamines, including dopamine, epinephrine, and norepinephrine, which play critical roles in the central nervous system and various physiological processes. COMT catalyzes the methylation of catechol compounds, thereby regulating their levels and activity within the brain and other tissues. Dysregulation of COMT activity has been implicated in several neuropsychiatric disorders, including schizophrenia, bipolar disorder, and attention deficit hyperactivity disorder (ADHD), making it a focal point for therapeutic research. The study of recombinant COMT protein is crucial for understanding its structure-function relationships, enzymatic mechanisms, and interactions with other proteins and ligands. By producing and purifying recombinant COMT, researchers can conduct detailed biochemical assays and structural analyses, which are essential for identifying potential inhibitors or activators of the enzyme. Furthermore, studying COMT variants, particularly the Val158Met polymorphism, is significant for exploring genetic influences on enzyme activity and individual susceptibility to mental health disorders. Overall, research on recombinant COMT protein enhances our understanding of its biological role and therapeutic potential, paving the way for innovative strategies in the treatment of COMT-related disorders.











