Cat: PA1000-9355

Recombinant Human PLP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PLP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PLP1;PLP;Myelin proteolipid Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P60201

  • Expression Region

    2-277aa

  • AA Sequence

    GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYF SKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIF GDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDK FVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLC ADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATL VSLLTFMIAATYNFAVLKLMGRGTKF

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PLP1 (Proteolipid Protein 1) is a crucial myelin-related protein predominantly expressed in oligodendrocytes, the myelinating cells of the central nervous system (CNS). Mutations or dysregulation of PLP1 are implicated in several demyelinating diseases, including Pelizaeus-Merzbacher disease, a severe neurodegenerative disorder characterized by hypomyelination. Given the importance of PLP1 in myelin formation and maintenance, its study has garnered considerable interest in the fields of neurobiology and regenerative medicine. Researchers utilize recombinant PLP1 proteins to investigate its structure-function relationships, post-translational modifications, and interactions with other myelin components. By using techniques such as protein expression in heterologous systems, purification, and functional assays, scientists aim to elucidate PLP1's role in myelination and its potential therapeutic implications for demyelinating conditions. Overall, understanding the intricacies of PLP1 biology not only enhances our comprehension of myelin pathophysiology but also guides the development of innovative strategies for repairing damaged CNS myelin.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US