Analytical Data
-
Gene name
CNOT7
- Application
-
Alternative Names
CNOT7；CAF1;CCR4-NOT transcription complex subunit 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UIV1
-
Expression Region
1-285aa
-
AA Sequence
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
-
Molecular Weight
36.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNOT7, a key component of the CCR4-NOT complex, plays a significant role in mRNA deadenylation and degradation, thereby influencing gene expression regulation. The study of CNOT7 is crucial because it participates in various cellular processes, including mRNA turnover, translation regulation, and the response to stress. Dysregulation of CNOT7 has been associated with several diseases, including cancer, where it may contribute to tumor development and progression by altering the stability of specific mRNAs involved in cell cycle regulation and apoptosis. Researchers have focused on characterizing CNOT7 through methods such as protein expression, purification, and enzymatic activity assays to better understand its functional mechanisms. Furthermore, understanding the structure and interactions of CNOT7 with other molecular partners can provide insights into its regulatory pathways and offers potential therapeutic targets. Overall, the research on CNOT7 recombinant protein is essential for elucidating its roles in cellular homeostasis and disease, paving the way for innovative approaches in biotechnology and medicine.
