Analytical Data
-
Gene name
NPHN
- Application
-
Alternative Names
NPHN；NPHN；Nephrin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60500
-
Expression Region
33-122aa
-
AA Sequence
GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPR YRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NPHN (Nuclear Pore Complex Protein) recombinant protein research has gained significant interest due to its critical role in cellular functions, particularly in nucleocytoplasmic transport, which is essential for maintaining cellular homeostasis and regulating gene expression. The Nuclear Pore Complex (NPC) is a large protein assembly that spans the nuclear envelope, facilitating the selective transport of proteins and RNA molecules between the nucleus and cytoplasm. Abnormalities in NPHN proteins have been implicated in various diseases, including cancer and neurodegenerative disorders, highlighting their importance in health and disease. Recent advancements in recombinant DNA technology and protein expression systems have enabled the production of NPHN proteins, which provide valuable tools for studying their structure, function, and interactions within the NPC. Additionally, the ability to produce these proteins in a high-purity form allows researchers to explore their potential as therapeutic targets or biomarkers. Understanding the mechanistic roles of NPHN proteins may lead to new insights into the development of diagnostic and treatment strategies for NPC-related diseases, ultimately contributing to improved healthcare outcomes.
