Analytical Data
-
Gene name
CETN1
- Application
-
Alternative Names
CETN1；CEN1；CETN；Centrin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12798
-
Expression Region
1-172aa
-
AA Sequence
MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
-
Molecular Weight
46.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CETN1, or Centrin 1, is a member of the centrin protein family, which plays a significant role in various cellular processes, including cell division and the regulation of the centrosome cycle. Research into CETN1 has gained attention due to its involvement in the formation and maintenance of microtubule-organizing centers, which are crucial for proper mitotic spindle formation and accurate chromosome segregation. Dysregulation of CETN1 has been associated with several diseases, including certain cancers, where abnormal centrosome function can lead to chromosomal instability. Additionally, CETN1 is implicated in several developmental processes and is essential for the function of cilia and flagella in various cell types. Recent studies have focused on the molecular mechanisms underlying CETN1's role in these biological processes, and researchers have explored its potential as a therapeutic target. By using recombinant CETN1 proteins in vitro, scientists aim to dissect its interactions with other cellular components and to better understand its function in both normal and pathological states. Understanding the structure and function of CETN1 could provide insights into its broader implications in cell biology and disease, as well as pave the way for novel therapeutic approaches targeting centrosome-related disorders. Overall, the study of CETN1 continues to be a promising and dynamic field, with potential implications for understanding fundamental cellular mechanisms and developing innovative treatments for related diseases.
