Cat: PA1000-9290

Recombinant Human NPTX2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NPTX2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NPTX2;Neuronal pentraxin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P47972

  • Expression Region

    1-431aa

  • AA Sequence

    MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQG GAQSPEEELRAAVLQLRETVVQQKETLGAQREAIRELTGKLARCEGLAGG KARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLESLEHQLRANVS NAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTES TLNALLQRVTELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAF TICLWLRSSASPGIGTPFSYAVPGQANEIVLIEWGNNPIELLINDKVAQL PLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVL ILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPG NIIPWVDNNVDVFGGASKWPVETCEERLLDL

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NPTX2, or Neuronal Pentraxin 2, is a member of the neuronal pentraxin family, which plays a crucial role in synaptic function and neuronal communication. This protein is predominantly expressed in the central nervous system and is implicated in various neurological processes, including synaptic plasticity, memory formation, and the clearance of apoptotic cells. Research has shown that NPTX2 is involved in the modulation of synaptic strength and may contribute to the pathophysiology of neurodegenerative diseases, such as Alzheimer's disease and schizophrenia. Given its importance in neuronal signaling, the recombinant expression of NPTX2 facilitates the investigation of its biochemical properties, interactions with other synaptic proteins, and its role in synapse development and maintenance. By studying NPTX2 in a controlled laboratory setting, researchers aim to uncover the molecular mechanisms underlying synaptic dysfunction associated with various neurological disorders. Furthermore, recombinant NPTX2 protein can serve as a valuable tool for the development of therapeutic strategies aimed at restoring synaptic integrity and function in affected individuals. Thus, the investigation of NPTX2 not only enhances our understanding of synaptic biology but also holds potential for identifying novel targets for drug development in the realm of neuropsychiatric disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US