Analytical Data
-
Gene name
CD33
- Application
-
Alternative Names
CD33；SIGLEC3；Myeloid cell surface antigen CD33
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20138
-
Expression Region
18-259aa
-
AA Sequence
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
-
Molecular Weight
56.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD33 (Cluster of Differentiation 33) is a sialic acid-binding immunoglobulin-like lectin predominantly expressed on myeloid cells, including monocytes, macrophages, and dendritic cells. It plays a critical role in the regulation of immune responses and is implicated in the pathogenesis of various hematologic malignancies, particularly acute myeloid leukemia (AML). The expression of CD33 on the surface of leukemic cells has made it an appealing target for immunotherapeutic strategies, including the development of monoclonal antibodies and antibody-drug conjugates. Researchers have focused on the engineering of CD33 recombinant proteins to better understand its structural and functional properties, facilitating the discovery of novel therapies. Studies exploring CD33's role in myeloid differentiation and its interactions with sialic acids also provide insights into its potential as a therapeutic target. Given the urgent need for effective treatments for AML and other CD33-positive malignancies, the development of CD33-targeted therapies through recombinant protein technology holds significant promise, paving the way for innovative approaches in cancer treatment and enhancing the body's immune response against tumor cells. Furthermore, understanding the molecular mechanisms by which CD33 influences immune modulation could lead to breakthroughs in enhancing the efficacy of existing therapies and addressing resistance mechanisms in malignancies.
