Analytical Data
-
Gene name
CCL18
- Application
-
Alternative Names
CCL18；AMAC1；DCCK1；MIP4；C-C motif chemokine 18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55774
-
Expression Region
21-89aa
-
AA Sequence
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC ADPNKKWVQKYISDLKLNA
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL18, a member of the CC chemokine family, plays a significant role in immune responses and inflammation regulation. This chemokine is primarily produced by macrophages and dendritic cells and is known to be involved in various physiological and pathological processes, including allergy, asthma, and cancer progression. Its unique ability to attract various immune cells makes it a key player in the modulation of immune responses. Research has shown that elevated levels of CCL18 are associated with chronic inflammatory diseases, suggesting its potential as a biomarker for disease progression and therapeutic targets. The study of recombinant CCL18 protein has gained traction as researchers aim to elucidate its exact mechanisms of action and interactions with immune cells. Moreover, understanding its structure-function relationship is critical for the development of therapeutic interventions that may mitigate its role in diseases characterized by excessive inflammation or aberrant immune activation. As a result, CCL18 is not only a pivotal molecule for understanding immune regulation but also a promising candidate for novel therapeutic strategies, making it a focus of ongoing research in immunology and related fields.
