Analytical Data
-
Gene name
CCL14
- Application
-
Alternative Names
CCL14；NCC2；SCYA14；C-C motif chemokine 14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16627
-
Expression Region
22-93aa
-
AA Sequence
TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRG HSVCTNPSDKWVQDYIKDMKEN
-
Molecular Weight
9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL14, also known as Chemokine (C-C motif) ligand 14, is a member of the CC chemokine family, primarily involved in immune responses and inflammatory processes. Research has increasingly focused on CCL14 due to its potential roles in regulating immune cell trafficking and influencing inflammatory diseases. Preliminary studies suggest that CCL14 may play a crucial role in the recruitment of specific immune cells to tissues during inflammation, as well as in tumor microenvironments. The recombinant production of CCL14 allows for detailed investigations into its biological functions and mechanisms, enabling researchers to explore its therapeutic potential. Understanding the role of CCL14 in immune modulation may provide insights into novel treatment strategies for a range of conditions, including autoimmune diseases and cancer. Additionally, studying its interactions with specific receptors can elucidate its signaling pathways and biological activities. By examining the properties and effects of CCL14 through recombinant techniques, researchers aim to pave the way for new diagnostic and therapeutic approaches that leverage this chemokine's unique characteristics for clinical applications.
