Analytical Data
-
Gene name
CCDC90B
- Application
-
Alternative Names
CCDC90B；Coiled-coil domain-containing Protein 90B. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZT6
-
Expression Region
43-230aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSGYDRRPVDITPLEQRKLTFDTHALVQD LETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHL DAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLD INLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIAS LKTLMESNKLE
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC90B (Coiled-Coil Domain Containing 90B) is a protein that has garnered attention in recent years due to its potential role in various biological processes and disease mechanisms, particularly in cancer and developmental disorders. This protein is characterized by its coiled-coil domain, which is known to facilitate protein-protein interactions, implying a critical function in cellular signaling pathways and structural organization. Studies have indicated that CCDC90B may be involved in regulating the cytoskeleton, cellular proliferation, and differentiation. Moreover, aberrations in its expression levels have been linked to tumorigenesis, making it a candidate for further investigation in cancer biology. The recombinant expression of CCDC90B allows researchers to obtain large quantities of the protein for biochemical assays, structural studies, and functional analyses, thereby advancing our understanding of its role in cellular mechanisms. Additionally, examining the interactions and pathways involving CCDC90B may reveal novel therapeutic targets, providing insights that could lead to innovative treatments for diseases associated with its dysregulation. Overall, the study of recombinant CCDC90B is pivotal for elucidating its biological functions and its implications in health and disease.
