Analytical Data
-
Gene name
PLAC9
- Application
-
Alternative Names
PLAC9；Placenta-specific Protein 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5JTB6
-
Expression Region
23-97aa
-
AA Sequence
AEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF
-
Molecular Weight
15.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLAC9, or placenta-specific 9, is a protein that has garnered significant attention due to its potential roles in pregnancy and placental development. Initially identified for its high expression in the placenta, research indicates that PLAC9 may be involved in various biological processes, including cellular signaling, immune modulation, and tissue remodeling. Its expression levels have been linked to various reproductive health conditions and complications, making it a candidate for understanding placental function and pathologies such as preeclampsia and fetal growth restriction. Recent studies have focused on the characterization of PLAC9 as a recombinant protein, aiming to elucidate its structural and functional properties. This research is crucial for advancing our understanding of how PLAC9 interacts with other molecules and its overall role in placental biology. Additionally, exploring PLAC9 as a biomarker could provide insights into pregnancy health, offering potential diagnostic and therapeutic avenues. The investigation into PLAC9’s mechanisms and functions continues to be a promising area within reproductive biology, with implications not only in obstetrics but also in understanding broader aspects of cell biology and immunology.
