Cat: PA1000-9201

Recombinant Human PLAC9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PLAC9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PLAC9;Placenta-specific Protein 9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5JTB6

  • Expression Region

    23-97aa

  • AA Sequence

    AEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF

  • Molecular Weight

    15.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PLAC9, or placenta-specific 9, is a protein that has garnered significant attention due to its potential roles in pregnancy and placental development. Initially identified for its high expression in the placenta, research indicates that PLAC9 may be involved in various biological processes, including cellular signaling, immune modulation, and tissue remodeling. Its expression levels have been linked to various reproductive health conditions and complications, making it a candidate for understanding placental function and pathologies such as preeclampsia and fetal growth restriction. Recent studies have focused on the characterization of PLAC9 as a recombinant protein, aiming to elucidate its structural and functional properties. This research is crucial for advancing our understanding of how PLAC9 interacts with other molecules and its overall role in placental biology. Additionally, exploring PLAC9 as a biomarker could provide insights into pregnancy health, offering potential diagnostic and therapeutic avenues. The investigation into PLAC9’s mechanisms and functions continues to be a promising area within reproductive biology, with implications not only in obstetrics but also in understanding broader aspects of cell biology and immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US