Analytical Data
-
Gene name
MPIF2
- Application
-
Alternative Names
MPIF2；MPIF2；SCYA24；C-C motif chemokine 24
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00175
-
Expression Region
27-104aa
-
AA Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGD PKQEWVQRYMKNLDAKQKKASPRARAVA
-
Molecular Weight
9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MPIF2 (Monocyte Peptide Involved in Fibrosis 2), also known as CCL22, is a chemokine that plays a crucial role in immune responses and inflammation. It is primarily produced by monocytes, macrophages, and dendritic cells, promoting the recruitment of regulatory T cells and influencing the balance between immune tolerance and activation. Research into MPIF2 has gained momentum due to its implications in various pathological conditions, including chronic inflammatory diseases, autoimmune disorders, and cancer. Understanding the role of MPIF2 in these contexts could help identify potential therapeutic targets for modulating immune responses. The study of recombinant MPIF2 protein facilitates the exploration of its biological functions and interactions in vitro and in vivo, allowing researchers to delve into its signaling pathways and molecular mechanisms. Furthermore, recombinant techniques enable the production of pure MPIF2 for use in functional assays, enabling the investigation of its effects on cell migration, activation, and differentiation. Overall, the ongoing research on MPIF2 not only enhances our understanding of its contribution to immune regulation but also opens avenues for developing novel strategies in treating diseases characterized by dysregulated immune responses.
