Analytical Data
-
Gene name
CBR1
- Application
-
Alternative Names
CBR1；CBR；CRN；SDR21C1；Carbonyl reductase [NADPH] 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16152
-
Expression Region
2-277aa
-
AA Sequence
SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
-
Molecular Weight
32.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CBR1 (Carbonyl Reductase 1) is an enzyme that belongs to the alcohol dehydrogenase family and plays a crucial role in the metabolism of various carbonyl compounds, including drugs and endogenous metabolites. Its enzymatic activity is pivotal for the reduction of toxic carbonyls into less harmful alcohols, thereby participating in cellular detoxification processes. Moreover, CBR1 has been implicated in the biotransformation of certain pharmacological agents, affecting their efficacy and toxicity. Given its significance in drug metabolism and potential role in disease mechanisms, particularly in cancer and neurodegenerative disorders, understanding the structure-function relationship of CBR1 through recombinant protein studies has become a critical area of research. Advances in recombinant DNA technology allow for the production of CBR1 in sufficient quantities for detailed biochemical and pharmacological analyses. This enables the exploration of its catalytic properties, substrate specificity, and inhibitor interactions, ultimately contributing to the development of CBR1-targeted therapeutic strategies. Furthermore, studying the polymorphisms and expression patterns of CBR1 could provide insights into individual variations in drug responses, thereby enhancing personalized medicine approaches. Overall, the investigation of CBR1 as a recombinant protein holds promise for uncovering its multifaceted roles in metabolism and pharmacology, paving the way for novel therapeutic interventions and improved drug design.
