Analytical Data
-
Gene name
CBFB
- Application
-
Alternative Names
CBFB；Nuclear transcription factor Y subunit alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13951
-
Expression Region
1-182aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPRVVPDQRSKFENEEFFRKLSRECEIKYT GFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQT PSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEE RAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTT RP
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CBFB, or core-binding factor beta, is a key regulatory protein that plays a crucial role in hematopoiesis and gene transcription through its interaction with the transcription factor RUNX. Abnormalities in the CBFB gene, such as mutations and translocations, have been linked to various hematological malignancies, including acute myeloid leukemia (AML) and myelodysplastic syndromes. These alterations can disrupt normal gene expression patterns, leading to hematopoietic dysregulation and the development of cancer. As a result, understanding the structure and function of the CBFB protein, as well as its interactions with RUNX and other proteins, is essential for elucidating the molecular mechanisms underlying these diseases. Research in this area has indicated that restoring normal CBFB function may have therapeutic potential in treating CBFB-related malignancies. Furthermore, the development of CBFB recombinant proteins for research purposes has emerged as a significant focus, allowing scientists to dissect its functional roles and explore potential interventions. This research not only contributes to the fundamental understanding of CBFB but also paves the way for innovative strategies in cancer therapy, highlighting the importance of targeted approaches in the treatment of hematological disorders.
