Analytical Data
-
Gene name
CASP3
- Application
-
Alternative Names
CASP3；CPP32；Caspase-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42574
-
Expression Region
1-277aa
-
AA Sequence
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII NNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM RDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA PGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESF SFDATFHAKKQIPCIVSMLTKELYFYHHHHHHH
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Caspase-3 (CASP3) is an essential protease that plays a pivotal role in the apoptotic pathway, the process of programmed cell death critical for maintaining cellular homeostasis and normal development. Dysregulation of CASP3 activity has been implicated in various diseases, including cancer, neurodegenerative disorders, and autoimmune conditions, which highlights its importance as a therapeutic target. The study of recombinant CASP3 has gained traction as it allows for a detailed investigation of its structure-function relationships and enzymatic mechanisms. Producing recombinant CASP3 in a controlled laboratory setting enables researchers to obtain large quantities of the protein for biochemical assays, crystallography, and high-throughput screening of potential inhibitors. This research is pivotal not only for understanding the fundamental biology of apoptosis but also for the development of novel drugs aimed at modulating CASP3 activity. By elucidating how CASP3 interacts with different substrates and regulatory proteins, scientists aim to uncover new insights into the apoptotic pathways and their implications in disease. Furthermore, the role of CASP3 in inflammation and cell proliferation has opened new avenues for exploration, making recombinant CASP3 a valuable tool in both basic and applied biomedical research. The overall goal of these studies is to leverage CASP3's mechanisms to inform therapeutic strategies that can manipulate cell death processes effectively, offering potential interventions for a range of pathological conditions.
