Analytical Data
-
Gene name
CAMLG
- Application
-
Alternative Names
CAMLG；CAML；GET2；Guided entry of tail-anchored Proteins factor CAMLG
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49069
-
Expression Region
1-189aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMESMAVATDGGERPGVPAGSGLSASQR RAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLS VPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDV NLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQE DGNTTEEFDSFR
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CAMLG (Calcium-modulating ligand of GRP) is a protein that plays a crucial role in cellular signaling and calcium homeostasis. Research on CAMLG has gained significance due to its involvement in various physiological processes and potential implications in pathological conditions, including neurodegenerative diseases and cancers. The protein is known to interact with multiple signaling pathways, influencing processes such as cell proliferation, differentiation, and apoptosis. Its unique structure, which includes specific domains that facilitate calcium binding and interaction with other cellular partners, makes CAMLG a compelling subject for functional studies and therapeutic exploration. Advances in recombinant protein technology have enabled the production of CAMLG in a controlled laboratory setting, allowing detailed investigation of its biophysical properties and biological functions. By studying CAMLG's mechanisms of action and its role in cellular contexts, researchers aim to uncover new insights into its contributions to health and disease, potentially paving the way for the development of novel therapeutic strategies targeting CAMLG-related pathways. Such research is critical as it may reveal targeted interventions for conditions where calcium signaling is disrupted, offering hope for more effective treatments in the future.
