Cat: PA1000-414DB

Recombinant Human CAMLG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CAMLG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CAMLG;CAML;GET2;Guided entry of tail-anchored Proteins factor CAMLG

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49069

  • Expression Region

    1-189aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMESMAVATDGGERPGVPAGSGLSASQR RAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLS VPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDV NLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQE DGNTTEEFDSFR

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CAMLG (Calcium-modulating ligand of GRP) is a protein that plays a crucial role in cellular signaling and calcium homeostasis. Research on CAMLG has gained significance due to its involvement in various physiological processes and potential implications in pathological conditions, including neurodegenerative diseases and cancers. The protein is known to interact with multiple signaling pathways, influencing processes such as cell proliferation, differentiation, and apoptosis. Its unique structure, which includes specific domains that facilitate calcium binding and interaction with other cellular partners, makes CAMLG a compelling subject for functional studies and therapeutic exploration. Advances in recombinant protein technology have enabled the production of CAMLG in a controlled laboratory setting, allowing detailed investigation of its biophysical properties and biological functions. By studying CAMLG's mechanisms of action and its role in cellular contexts, researchers aim to uncover new insights into its contributions to health and disease, potentially paving the way for the development of novel therapeutic strategies targeting CAMLG-related pathways. Such research is critical as it may reveal targeted interventions for conditions where calcium signaling is disrupted, offering hope for more effective treatments in the future.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US