Analytical Data
-
Gene name
CAMK2N2
- Application
-
Alternative Names
CAMK2N2;Calcium/calmodulin-dependent Protein kinase II inhibitor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96S95
-
Expression Region
1-79aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSEILPYSEDKMGRFGADPEGSDLSFS CRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPS GV
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CAMK2N2, or Calcium/Calmodulin-dependent Protein Kinase II Inhibitor 2, is part of the CAMK family of proteins that plays a pivotal role in cellular signaling pathways, particularly in neurons. CAMK2N2 acts as an endogenous inhibitor of CaMKII, a kinase involved in various physiological processes, including synaptic plasticity, learning, and memory. The importance of CAMK2N2 has been highlighted in several studies linking its dysregulation to neurodegenerative diseases and psychiatric disorders. Recent research has focused on the reconstitution of the CAMK2N2 protein to better understand its structure-function relationship and its regulatory mechanisms in calcium signaling. By producing recombinant CAMK2N2, researchers aim to investigate its biochemical properties, interaction with CaMKII, and potential therapeutic applications. This research might elucidate the protective roles of CAMK2N2 in neurological contexts and could lead to novel insights into treatments for conditions like Alzheimer's disease and schizophrenia, where calcium signaling is often disrupted. Moreover, understanding how CAMK2N2 modulates CaMKII activity could provide broader insights into cell signaling dynamics, opening avenues for further exploration in cellular biology and pharmacology. Thus, investigating the properties of recombinant CAMK2N2 is crucial for advancing our knowledge of its role in health and disease.











