Cat: PA1000-9161

Recombinant Human EDA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EDA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EDA;ED1;EDA2;Ectodysplasin-A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92838

  • Expression Region

    245-391aa

  • AA Sequence

    ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELE VLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYN TCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of EDA (Ectodysplasin A) recombinant proteins has gained significant attention due to their critical role in the development of ectodermal structures, including hair, teeth, and sweat glands. Mutations in the EDA gene can lead to X-linked hypohidrotic ectodermal dysplasia, a hereditary condition characterized by the absence or malformation of these structures, significantly impacting the quality of life of affected individuals. Understanding the function and mechanisms of EDA is essential for developing potential therapeutic strategies, including gene therapy and protein replacement therapies. Advances in recombinant protein technology allow for the production of EDA and its variants, enabling researchers to investigate the protein's interactions, signaling pathways, and biological effects in cell and animal models. Moreover, studies utilizing EDA recombinant proteins have provided insights into the molecular basis of ectodermal development and highlighted potential pathways for intervention in related disorders. As a result, research into EDA recombinant proteins not only enhances our understanding of fundamental biological processes but also paves the way for novel treatments that could improve health outcomes for individuals with ectodermal dysplasia and related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US