Analytical Data
-
Gene name
EDA
- Application
-
Alternative Names
EDA；ED1；EDA2；Ectodysplasin-A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92838
-
Expression Region
245-391aa
-
AA Sequence
ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELE VLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYN TCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of EDA (Ectodysplasin A) recombinant proteins has gained significant attention due to their critical role in the development of ectodermal structures, including hair, teeth, and sweat glands. Mutations in the EDA gene can lead to X-linked hypohidrotic ectodermal dysplasia, a hereditary condition characterized by the absence or malformation of these structures, significantly impacting the quality of life of affected individuals. Understanding the function and mechanisms of EDA is essential for developing potential therapeutic strategies, including gene therapy and protein replacement therapies. Advances in recombinant protein technology allow for the production of EDA and its variants, enabling researchers to investigate the protein's interactions, signaling pathways, and biological effects in cell and animal models. Moreover, studies utilizing EDA recombinant proteins have provided insights into the molecular basis of ectodermal development and highlighted potential pathways for intervention in related disorders. As a result, research into EDA recombinant proteins not only enhances our understanding of fundamental biological processes but also paves the way for novel treatments that could improve health outcomes for individuals with ectodermal dysplasia and related conditions.
