Analytical Data
-
Gene name
SYN1
- Application
-
Alternative Names
SYN1；Synapsin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17600
-
Expression Region
113-420aa
-
AA Sequence
SRVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR
-
Molecular Weight
41.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYN1, or synapsin 1, is a key neuronal protein involved in the regulation of neurotransmitter release and synaptic vesicle dynamics. Research on SYN1 has gained prominence due to its critical role in synaptic function, particularly in the context of neuronal communication and plasticity. Disruptions in SYN1 expression and function have been linked to various neurological disorders, including schizophrenia, autism, and epilepsy, making it a significant target for understanding the underlying mechanisms of these conditions. The protein is known to anchor synaptic vesicles to the presynaptic cytoskeleton and play a role in their mobilization during synaptic activity. Furthermore, studies have shown that SYN1 is involved in neurodevelopmental processes, highlighting its importance during early brain development and its potential impact on cognitive functions. Ongoing research aims to elucidate the molecular pathways associated with SYN1, its interactions with other synaptic proteins, and how these relationships are affected in pathological states. Additionally, understanding SYN1's mechanism of action could pave the way for novel therapeutic strategies aimed at modulating synaptic function in various neurological diseases. This makes SYN1 a central figure in the field of neuroscience, providing insights into both normal brain function and the pathophysiology of numerous synaptic disorders.
