Analytical Data
-
Gene name
BRD2
- Application
-
Alternative Names
BRD2；KIAA9001；RING3；Bromodomain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25440
-
Expression Region
65-187aa
-
AA Sequence
EVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYH KIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVL MAQTLEKIFLQKVASMPQEEQEL
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BRD2 (Bromodomain containing 2) is a member of the bromodomain and extraterminal (BET) protein family, which plays a crucial role in regulating gene expression through interaction with acetylated lysine residues on histones and non-histone proteins. This interaction is vital for various cellular processes, including transcriptional regulation, cell cycle progression, and differentiation. Dysregulation of BRD2 has been implicated in several diseases, notably cancer and inflammatory disorders. Studies have shown that BRD2 can influence the expression of oncogenes, thereby contributing to tumorigenesis. Due to its pivotal role in epigenetic regulation, BRD2 has emerged as a promising therapeutic target. Researchers are increasingly focusing on the development of BRD2 inhibitors to explore their potential in cancer treatment. Moreover, the production of recombinant BRD2 proteins is essential for elucidating its molecular mechanisms and interactions. By employing advanced protein expression systems, scientists aim to generate highly pure and functional BRD2 proteins that can be used in biochemical assays, structural studies, and drug discovery efforts. Understanding the structure-function relationship of BRD2 will facilitate the identification of specific inhibitors and enhance our overall comprehension of its role in health and disease. Thus, the study of BRD2, particularly through the lens of recombinant protein research, is crucial for advancing therapeutic strategies aimed at modulating its activity in various pathological conditions.
