Cat: PA1000-364DB

Recombinant Human BRAF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BRAF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BRAF;BRAF1;RAFB1;Serine/threonine-Protein kinase B-raf

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15056

  • Expression Region

    381-766aa

  • AA Sequence

    DLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSS SSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQ WCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSN NIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDK NPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSK VRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASE PSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH

  • Molecular Weight

    69 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BRAF (B-Raf proto-oncogene, serine/threonine kinase) is a critical component of the RAS-RAF-MEK-ERK signaling pathway, which regulates cell proliferation, differentiation, and survival. Mutations in the BRAF gene, particularly the V600E mutation, are frequently associated with various cancers, including melanoma, thyroid, and colorectal cancers, leading to aberrant activation of this pathway. This has prompted extensive research into BRAF as a therapeutic target; selective BRAF inhibitors, such as vemurafenib and dabrafenib, have been developed and are used in clinical settings for treating BRAF-mutant tumors. However, resistance to these therapies often develops, necessitating further investigation into BRAF’s structural characteristics and interactions with other proteins. Recombinant BRAF proteins, produced through genetic engineering techniques, facilitate the study of its function in cellular signaling as well as the exploration of novel inhibitors. Additionally, these recombinant proteins enable researchers to examine the effects of specific mutations on BRAF activity and drug resistance mechanisms, thereby enhancing our understanding of tumor biology and paving the way for the development of more effective treatments. Understanding BRAF’s role in cancer also extends to potential combination therapies that target multiple points in the signaling pathway, aiming to circumvent resistance and improve patient outcomes. This comprehensive approach underscores the importance of BRAF research in the field of oncology and personalized medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US